Edit |   |
Antigenic Specificity | DOC2B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 97%, rat 97%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human DOC2B polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LKKLKPNHTKTFSICLEKQLPVDKTEDKSLEE |
Other Names | double C2-like domains, beta, DOC2BL |
Gene, Accession # | Gene ID: 8447, UniProt: None, ENSG00000272636 |
Catalog # | HPA043168 |
Price | |
Order / More Info | DOC2B Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |