| Edit |   |
|---|
| Antigenic Specificity | TDRD12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, bovine, porcine, horse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TDRD12 Antibody |
|---|
| Immunogen | The immunogen for Anti-TDRD12 Antibody is: synthetic peptide directed towards the C-terminal region of Human TDRD12. Synthetic peptide located within the following region: DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY |
|---|
| Other Names | ECAT8, tudor domain containing 12 |
|---|
| Gene, Accession # | TDR12, Accession: NM_001110822 |
|---|
| Catalog # | TA332195 |
|---|
| Price | |
|---|
| Order / More Info | TDRD12 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|