| Edit |   |
|---|
| Antigenic Specificity | SLC8A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SLC8A3 Antibody |
|---|
| Immunogen | The immunogen for Anti-SLC8A3 Antibody: synthetic peptide directed towards the N terminal of human SLC8A3. Synthetic peptide located within the following region: SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE |
|---|
| Other Names | NCX3, solute carrier family 8 (sodium/calcium exchanger), member 3 |
|---|
| Gene, Accession # | NAC3, Accession: NM_033262 |
|---|
| Catalog # | TA333587 |
|---|
| Price | |
|---|
| Order / More Info | SLC8A3 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|