| Edit |   |
|---|
| Antigenic Specificity | DRAP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal anti-DRAP1 antibody |
|---|
| Immunogen | The immunogen for anti-DRAP1 antibody: synthetic peptide directed towards the N terminal of human DRAP1. Synthetic peptide located within the following region: MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLL |
|---|
| Other Names | NC2alpha, DR1-associated protein 1 (negative cofactor 2 alpha) |
|---|
| Gene, Accession # | NC2A, Accession: NM_006442 |
|---|
| Catalog # | TA329305 |
|---|
| Price | |
|---|
| Order / More Info | DRAP1 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|