| Edit |   |
| Antigenic Specificity | SHQ1 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse; human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-SHQ1 Antibody - N-terminal region |
| Immunogen | The immunogen for Anti-Shq1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Shq1. Synthetic peptide located within the following region: PYFLRLTLPGRIVENGSEQGTYDADKGIFTIRLPKETPGQHFEGLNMLTA |
| Other Names | Shq1p, SHQ1, H/ACA ribonucleoprotein assembly factor |
| Gene, Accession # | SHQ1, Accession: NM_018130 |
| Catalog # | TA344926 |
| Price | |
| Order / More Info | SHQ1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |