| Edit |   |
| Antigenic Specificity | Slc12a5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-Slc12a5 Antibody |
| Immunogen | The immunogen for Anti-Slc12a5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS |
| Other Names | KCC2, solute carrier family 12 (potassium/chloride transporter), member 5 |
| Gene, Accession # | S12A5, Accession: NM_020708 |
| Catalog # | TA333735 |
| Price | |
| Order / More Info | Slc12a5 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |