| Edit |   |
|---|
| Antigenic Specificity | TRIM49C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TRIM49C Antibody |
|---|
| Immunogen | The immunogen for Anti-TRIM49C Antibody is: synthetic peptide directed towards the N-terminal region of Human TRIM49C. Synthetic peptide located within the following region: QCSECTKSTEQINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETK |
|---|
| Other Names | TRIM49L2, tripartite motif containing 49C |
|---|
| Gene, Accession # | TRIM49C, Accession: NM_001195234 |
|---|
| Catalog # | TA332153 |
|---|
| Price | |
|---|
| Order / More Info | TRIM49C Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|