| Edit |   |
| Antigenic Specificity | ZNF447 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat, mouse, rabbit, dog |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ZNF447 Antibody |
| Immunogen | The immunogen for Anti-ZNF447 Antibody: synthetic peptide directed towards the N terminal of human ZNF447. Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL |
| Other Names | ZNF447, zinc finger and SCAN domain containing 18 |
| Gene, Accession # | ZSC18, Accession: NM_023926 |
| Catalog # | TA333689 |
| Price | |
| Order / More Info | ZNF447 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |