| Edit |   |
|---|
| Antigenic Specificity | ELK4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal anti-ELK4 antibody |
|---|
| Immunogen | The immunogen for anti-ELK4 antibody: synthetic peptide directed towards the C terminal of human ELK4. Synthetic peptide located within the following region: ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERL |
|---|
| Other Names | SAP1, ELK4, ETS-domain protein (SRF accessory protein 1) |
|---|
| Gene, Accession # | ELK4, Accession: NM_021795 |
|---|
| Catalog # | TA329226 |
|---|
| Price | |
|---|
| Order / More Info | ELK4 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|