| Edit |   |
| Antigenic Specificity | Gtpbp10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | n/a |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal anti-Gtpbp10 Antibody |
| Immunogen | The immunogen for Anti-Gtpbp10 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gtpbp10. Synthetic peptide located within the following region: MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDVWVVAH |
| Other Names | n/a |
| Gene, Accession # | Gtpbp10, Accession: NM_001100815 |
| Catalog # | TA329554 |
| Price | |
| Order / More Info | Gtpbp10 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |