| Edit |   |
| Antigenic Specificity | STK33 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-STK33 Antibody |
| Immunogen | The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the N-terminal region of Human STK33. Synthetic peptide located within the following region: VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE |
| Other Names | serine/threonine kinase 33 |
| Gene, Accession # | STK33, Accession: NM_030906 |
| Catalog # | TA331233 |
| Price | |
| Order / More Info | STK33 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |