| Edit |   |
|---|
| Antigenic Specificity | STK17A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-STK17A Antibody |
|---|
| Immunogen | The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A. Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE |
|---|
| Other Names | DRAK1, serine/threonine kinase 17a |
|---|
| Gene, Accession # | ST17A, Accession: NM_004760 |
|---|
| Catalog # | TA330331 |
|---|
| Price | |
|---|
| Order / More Info | STK17A Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|