| Edit |   |
| Antigenic Specificity | DPPA5 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | dog, human, mouse, porcine, rabbit |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-DPPA5 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-DPPA5 antibody: synthetic peptide directed towards the N terminal of human DPPA5. Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV |
| Other Names | ESG1, developmental pluripotency associated 5 |
| Gene, Accession # | DPPA5, Accession: NM_001025290 |
| Catalog # | TA344221 |
| Price | |
| Order / More Info | DPPA5 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |