| Edit |   |
| Antigenic Specificity | B4GALNT2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-B4GALNT2 Antibody |
| Immunogen | The immunogen for Anti-B4GALNT2 Antibody is: synthetic peptide directed towards the N-terminal region of Human B4GALNT2. Synthetic peptide located within the following region: FSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHF |
| Other Names | B4GALT, GALGT2, beta-1,4-N-acetyl-galactosaminyl transferase 2 |
| Gene, Accession # | B4GN2, Accession: NM_153446 |
| Catalog # | TA333466 |
| Price | |
| Order / More Info | B4GALNT2 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |