| Edit |   |
| Antigenic Specificity | MRPS2 - middle region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-MRPS2 Antibody - middle region |
| Immunogen | The immunogen for anti-MRPS2 antibody: synthetic peptide directed towards the middle region of human MRPS2. Synthetic peptide located within the following region: VHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHS |
| Other Names | MRPS2, S2mt, mitochondrial ribosomal protein S2 |
| Gene, Accession # | RT02, Accession: NM_016034 |
| Catalog # | TA345078 |
| Price | |
| Order / More Info | MRPS2 - middle region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |