| Edit |   |
| Antigenic Specificity | NAP1L2 - middle region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | dog, horse, human, rabbit, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-NAP1L2 Antibody - middle region |
| Immunogen | The immunogen for anti-NAP1L2 antibody: synthetic peptide directed towards the middle region of human NAP1L2. Synthetic peptide located within the following region: VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE |
| Other Names | BPX, nucleosome assembly protein 1-like 2 |
| Gene, Accession # | NP1L2, Accession: NM_021963 |
| Catalog # | TA344712 |
| Price | |
| Order / More Info | NAP1L2 - middle region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |