| Edit |   |
| Antigenic Specificity | NAP1L4 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse; human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-NAP1L4 Antibody - N-terminal region |
| Immunogen | The immunogen for Anti-Nap1l4 antibody is: synthetic peptide directed towards the N-terminal region of Nap1l4. Synthetic peptide located within the following region: HDLERKYAALYQPLFDKRREFITGDVEPTDAESAWHSENEEEDKLAGDMK |
| Other Names | NAP1L4b, NAP2, NAP2L, hNAP2, nucleosome assembly protein 1-like 4 |
| Gene, Accession # | NP1L4, Accession: NM_005969 |
| Catalog # | TA344383 |
| Price | |
| Order / More Info | NAP1L4 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |