| Edit |   |
| Antigenic Specificity | NAP1L2 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse; human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-NAP1L2 Antibody - N-terminal region |
| Immunogen | The immunogen for Anti-Nap1l2 antibody is: synthetic peptide directed towards the N-terminal region of Nap1l2. Synthetic peptide located within the following region: QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY |
| Other Names | BPX, nucleosome assembly protein 1-like 2 |
| Gene, Accession # | NP1L2, Accession: NM_021963 |
| Catalog # | TA344713 |
| Price | |
| Order / More Info | NAP1L2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |