| Edit |   |
| Antigenic Specificity | GABRB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-GABRB3 Antibody |
| Immunogen | The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: FYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK |
| Other Names | ECA5, gamma-aminobutyric acid (GABA) A receptor, beta 3 |
| Gene, Accession # | GBRB3, Accession: NM_021912 |
| Catalog # | TA329172 |
| Price | |
| Order / More Info | GABRB3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |