| Edit |   |
|---|
| Antigenic Specificity | SSBP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, human, guinea pig, dog, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SSBP4 Antibody |
|---|
| Immunogen | The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the middle region of human SSBP4. Synthetic peptide located within the following region: PHHVNGSLGSGDMDGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPF |
|---|
| Other Names | single stranded DNA binding protein 4 |
|---|
| Gene, Accession # | SSBP4, Accession: NM_032627 |
|---|
| Catalog # | TA341418 |
|---|
| Price | |
|---|
| Order / More Info | SSBP4 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|