| Edit |   |
| Antigenic Specificity | HSPC111 - middle region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human; mouse; rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-HSPC111 Antibody - middle region |
| Immunogen | The immunogen for anti-HSPC111 antibody: synthetic peptide directed towards the middle region of human HSPC111. Synthetic peptide located within the following region: RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR |
| Other Names | HSPC111, HSPC185, NOP16 nucleolar protein |
| Gene, Accession # | NOP16, Accession: NM_016391 |
| Catalog # | TA345030 |
| Price | |
| Order / More Info | HSPC111 - middle region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |