| Edit |   |
|---|
| Antigenic Specificity | CXXC5 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CXXC5 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for Anti-Cxxc5 antibody is synthetic peptide directed towards the N-terminal region of Mouse Cxxc5. Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD |
|---|
| Other Names | CF5, RINF, WID, CXXC finger protein 5 |
|---|
| Gene, Accession # | CXXC5, Accession: NM_133687 |
|---|
| Catalog # | TA344201 |
|---|
| Price | |
|---|
| Order / More Info | CXXC5 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|