| Edit |   |
| Antigenic Specificity | CXCL16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-CXCL16 Antibody |
| Immunogen | The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV |
| Other Names | n/a |
| Gene, Accession # | CXL16, Accession: NM_022059 |
| Catalog # | TA346139 |
| Price | |
| Order / More Info | CXCL16 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |