| Edit |   |
| Antigenic Specificity | RAD54B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, bovine, rabbit, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-RAD54B Antibody |
| Immunogen | The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN |
| Other Names | RDH54, RAD54 homolog B (S. cerevisiae) |
| Gene, Accession # | RA54B, Accession: NM_012415 |
| Catalog # | TA341583 |
| Price | |
| Order / More Info | RAD54B Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |