| Edit |   |
| Antigenic Specificity | Dnajc17 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-Dnajc17 Antibody |
| Immunogen | The immunogen for anti-Dnajc17 antibody: synthetic peptide directed towards the middle region of mouse Dnajc17. Synthetic peptide located within the following region: RQDREQRLRGRTENTEGKGTPKLKLKWKCKKEDESQGGYSRDVLLRLLQK |
| Other Names | DnaJ (Hsp40) homolog, subfamily C, member 17 |
| Gene, Accession # | Dnajc17, Accession: NM_139139 |
| Catalog # | TA329989 |
| Price | |
| Order / More Info | Dnajc17 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |