| Edit |   |
|---|
| Antigenic Specificity | PAFAH1B2 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | bovine, dog, human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-PAFAH1B2 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for anti-PAFAH1B2 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B2. Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV |
|---|
| Other Names | HELS303, platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) |
|---|
| Gene, Accession # | PA1B2, Accession: NM_002572 |
|---|
| Catalog # | TA344310 |
|---|
| Price | |
|---|
| Order / More Info | PAFAH1B2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|