| Edit |   |
| Antigenic Specificity | RALGPS2 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, dog, horse, mouse, rabbit, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-RALGPS2 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-RALGPS2 antibody: synthetic peptide directed towards the n terminal of human RALGPS2. Synthetic peptide located within the following region: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP |
| Other Names | dJ595C2.1, Ral GEF with PH domain and SH3 binding motif 2 |
| Gene, Accession # | RGPS2, Accession: NM_152663 |
| Catalog # | TA344942 |
| Price | |
| Order / More Info | RALGPS2 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |