| Edit |   |
| Antigenic Specificity | ELMOD1 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ELMOD1 Antibody - N-terminal region |
| Immunogen | The immunogen for Anti-ELMOD1 antibody is: synthetic peptide directed towards the N-terminal region of Human ELMOD1. Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA |
| Other Names | ELMO/CED-12 domain containing 1 |
| Gene, Accession # | ELMD1, Accession: NM_018712 |
| Catalog # | TA344839 |
| Price | |
| Order / More Info | ELMOD1 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |