| Edit |   |
| Antigenic Specificity | CAPZA3 - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | guinea pig, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-CAPZA3 Antibody - N-terminal region |
| Immunogen | The immunogen for anti-CAPZA3 antibody: synthetic peptide directed towards the N terminal of human CAPZA3. Synthetic peptide located within the following region: MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC |
| Other Names | CAPPA3, Gsg3, capping protein (actin filament) muscle Z-line, alpha 3 |
| Gene, Accession # | CAPZA3, Accession: NM_033328 |
| Catalog # | TA344270 |
| Price | |
| Order / More Info | CAPZA3 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |