| Edit |   |
|---|
| Antigenic Specificity | NDNF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, porcine, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-NDNF Antibody |
|---|
| Immunogen | The immunogen for Anti-NDNF antibody is: synthetic peptide directed towards the N-terminal region of Human NDNF. Synthetic peptide located within the following region: LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY |
|---|
| Other Names | C4orf31, neuron-derived neurotrophic factor |
|---|
| Gene, Accession # | NDNF, Accession: NM_024574 |
|---|
| Catalog # | TA330737 |
|---|
| Price | |
|---|
| Order / More Info | NDNF Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|