Edit |   |
Antigenic Specificity | CENPM |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 75%, rat 79%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human CENPM polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEG |
Other Names | centromere protein M, C22orf18, CENP-M, MGC861, Pane1 |
Gene, Accession # | Gene ID: 79019, UniProt: Q9NSP4, ENSG00000100162 |
Catalog # | HPA056500 |
Price | |
Order / More Info | CENPM Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |