| Edit |   |
|---|
| Antigenic Specificity | RPS3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human RPS3A polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLK |
|---|
| Other Names | ribosomal protein S3A, MFTL, S3A |
|---|
| Gene, Accession # | Gene ID: 6189, UniProt: P61247, ENSG00000145425 |
|---|
| Catalog # | HPA053454 |
|---|
| Price | |
|---|
| Order / More Info | RPS3A Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|