| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACTH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human mouse rat |
|---|
| Isotype | n/a |
|---|
| Format | immunoaffinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Recognizes human ACTH. Species Crossreactivity: mouse and rat |
|---|
| Immunogen | Synthetic peptide corresponding to aa138-176, SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, from the middle region of human ACTH, different from the related mouse and rat sequences by 2aa. |
|---|
| Other Names | ACTH (Adrenocorticotropic Hormone, Adrenocorticotropin, Adrenocorticotropin Hormone, Alpha Melanocyte Stimulating Hormone, Alpha-MSH, AlphaMSH, Beta Endorphin, Beta Lipotropin, Beta LPH, Beta Melanocyte Stimulating Hormone, Beta-Endorphin, Beta-MSH, CLIP, Corticotropin, Corticotropin Like Intermediary Peptide, Corticotropin Lipotropin, Corticotropin Lipotropin Precursor, Corticotropin-like Intermediary Peptide, Gamma LPH, Gamma-MSH, Lipotropin Beta, Lipotropin Gamma, Lipotropin, Included, LPH, Melanocyte-stimulating Hormone, Included, Melanotropin Alpha, Melanotropin Beta, Melanotropin Gamma, Melanotropin, Included, Met Enkephalin, Met-enkephalin, MSH, NPP, Opiomelanocortin Prepropeptide, POC, POMC, Pomc-1, Pomc1, Pomc2, Pro ACTH Endorphin, Pro Opiomelanocortin, Pro-opiomelanocortin-alpha, Proopiomelanocortin, Proopiomelanocortin Preproprotein, Tetracosactide) |
|---|
| Gene, Accession # | SwissProt: P01189 |
|---|
| Catalog # | 303094 |
|---|
| Price | |
|---|
| Order / More Info | ACTH Antibody from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|