| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LAMC2 |
|---|
| Clone | CL2980 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LAMC2 Antibody (CL2980) from Novus Biologicals is a mouse monoclonal antibody to LAMC2. This antibody reacts with human. The LAMC2 Antibody (CL2980) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse LAMC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLEN |
|---|
| Other Names | BM600, BM600-100kDa, Cell-scattering factor 140 kDa subunit, CSF, CSF 140 kDa subunit, EBR2, EBR2A, Epiligrin subunit gamma, kalinin (105kD), Kalinin subunit gamma, Kalinin/nicein/epiligrin 100 kDa subunit, kalinin-105kDa, ladsin (140kDa), Ladsin 140 kDa subunit, LAMB2Tlaminin, gamma 2 (nicein (100kD), kalinin (105kD), BM600 (100kD), Herlitzjunctional epidermolysis bullosa)), Laminin B2t chain, laminin subunit gamma-2, laminin, gamma 2, Laminin-5 subunit gamma, LAMNB2B2T, Large adhesive scatter factor 140 kDa subunit, MGC138491, MGC141938, nicein (100kDa), Nicein subunit gamma, nicein-100kDa |
|---|
| Gene, Accession # | LAMC2, Gene ID: 3918, Accession: Q13753, SwissProt: Q13753 |
|---|
| Catalog # | NBP2-42388 |
|---|
| Price | |
|---|
| Order / More Info | LAMC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|