Edit |   |
Antigenic Specificity | FAM167B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 84%, rat 84%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human FAM167B polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREM |
Other Names | family with sequence similarity 167, member B, C1orf90, MGC10820 |
Gene, Accession # | Gene ID: 84734, UniProt: Q9BTA0, ENSG00000183615 |
Catalog # | HPA062074 |
Price | |
Order / More Info | FAM167B Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |