| Edit |   |
|---|
| Antigenic Specificity | CLIC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 55%, rat 97%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human CLIC2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LEQTLAPPRYPHLSPKYKESFDVGCNLFAKF |
|---|
| Other Names | chloride intracellular channel 2, XAP121 |
|---|
| Gene, Accession # | Gene ID: 1193, UniProt: O15247, ENSG00000155962 |
|---|
| Catalog # | HPA060101 |
|---|
| Price | |
|---|
| Order / More Info | CLIC2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|