Edit |   |
Antigenic Specificity | BASP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 95%, rat 93%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Recombinant expression validation in WB using target protein overexpression. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human BASP1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP |
Other Names | brain abundant, membrane attached signal protein 1, CAP-23, CAP23, NAP-22, NAP22 |
Gene, Accession # | Gene ID: 10409, UniProt: P80723, ENSG00000176788 |
Catalog # | HPA045218 |
Price | |
Order / More Info | BASP1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |