| Edit |   |
|---|
| Antigenic Specificity | MAP1LC3C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 50%, rat 50%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human MAP1LC3C polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TKFLVPQELTMTQFLSIIRSRMVLRATEAF |
|---|
| Other Names | microtubule-associated protein 1 light chain 3 gamma, ATG8J |
|---|
| Gene, Accession # | Gene ID: 440738, UniProt: Q9BXW4, ENSG00000197769 |
|---|
| Catalog # | HPA072670 |
|---|
| Price | |
|---|
| Order / More Info | MAP1LC3C Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|