| Edit |   |
|---|
| Antigenic Specificity | RAD9A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-RAD9A Antibody |
|---|
| Immunogen | The immunogen for anti-RAD9A antibody: synthetic peptide directed towards the C terminal of human RAD9A. Synthetic peptide located within the following region: SLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPVRS |
|---|
| Other Names | RAD9, RAD9 homolog A (S. pombe) |
|---|
| Gene, Accession # | RAD9A, Accession: NM_004584 |
|---|
| Catalog # | TA330361 |
|---|
| Price | |
|---|
| Order / More Info | RAD9A Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|