| 产品详情 |
| Edit |   |
|---|
| Product Name | L3MBTL3, Recombinant, Human, aa229-547, GST-tag (Lethal(3) Malignant Brain Tumor-Like Protein 3) |
|---|
| Description | Highly Purified (~91%). PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Source: Recombinant protein corresponding to aa229-547 from human L3MBTL3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~63.6kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKKAW CWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAE VCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQT YLKTCKAQAAPKSLFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFL VHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETN SLPAPARAFKVKPPHGFQKKM |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | n/a |
|---|
| Gene, Accession, CAS # | Accession: NM_032438, SwissProt: Q96JM7 |
|---|
| Catalog # | 298424 |
|---|
| Price | |
|---|
| Order / More Info | L3MBTL3, Recombinant, Human, aa229-547, GST-tag (Lethal(3) Malignant Brain Tumor-Like Protein 3) from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|