| 产品详情 |
| Edit |   |
|---|
| Product Name | L3MBTL2, Recombinant, Human, aa178-625, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 2) |
|---|
| Description | Highly Purified (~90%). Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Binds to monomethylated and dimethylated 'Lys-20' on histone H4. Binds histone H3 peptides that are monomethylated or dimethylated on 'Lys-4', 'Lys-9' or 'Lys-27'. Source: Recombinant protein corresponding to aa178-625 from human L3MBTL2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.2kD AA Sequence: MHHHHHHGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSDAVL PSRVYWIASVIQTAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILVPP RTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRT RMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSD MAHHPTFRKIYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGNICVATVCKV |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | n/a |
|---|
| Gene, Accession, CAS # | Accession: NM_031488, SwissProt: Q969R5 |
|---|
| Catalog # | 298423 |
|---|
| Price | |
|---|
| Order / More Info | L3MBTL2, Recombinant, Human, aa178-625, His-Tag (Lethal(3) Malignant Brain Tumor-Like Protein 2) from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|