Edit |   |
Antigenic Specificity | DEGS2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 87%, rat 90%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human DEGS2 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLA |
Other Names | delta(4)-desaturase, sphingolipid 2, C14orf66, DES2, FADS8 |
Gene, Accession # | Gene ID: 123099, UniProt: Q6QHC5, ENSG00000168350 |
Catalog # | HPA046644 |
Price | |
Order / More Info | DEGS2 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |