Edit |   |
Antigenic Specificity | RNF170 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 89%, rat 91%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human RNF170 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETN |
Other Names | ring finger protein 170, ADSA, DKFZP564A022, SNAX1 |
Gene, Accession # | Gene ID: 81790, UniProt: Q96K19, ENSG00000120925 |
Catalog # | HPA054621 |
Price | |
Order / More Info | RNF170 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |