Edit |   |
Antigenic Specificity | CAMK2D |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 100%, rat 97%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human CAMK2D polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ |
Other Names | calcium/calmodulin-dependent protein kinase II delta, CAMKD |
Gene, Accession # | Gene ID: 817, UniProt: Q13557, ENSG00000145349 |
Catalog # | HPA026281 |
Price | |
Order / More Info | CAMK2D Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |