Edit |   |
Antigenic Specificity | RPL7L1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 88%, rat 93%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human RPL7L1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTPGYRGERINQLIRQLN |
Other Names | ribosomal protein L7-like 1, dJ475N16.4 |
Gene, Accession # | Gene ID: 285855, UniProt: Q6DKI1, ENSG00000146223 |
Catalog # | HPA050478 |
Price | |
Order / More Info | RPL7L1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |