Edit |   |
Antigenic Specificity | MAGEB18 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 38%, rat 41%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human MAGEB18 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: STTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPIT |
Other Names | melanoma antigen family B, 18, MGC33889 |
Gene, Accession # | Gene ID: 286514, UniProt: Q96M61, ENSG00000176774 |
Catalog # | HPA046141 |
Price | |
Order / More Info | MAGEB18 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |