Edit |   |
Antigenic Specificity | MAGEB2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 43%, rat 40%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human MAGEB2 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP |
Other Names | MAGE family member B2, CT3.2, DAM6, MAGE-XP-2, MGC26438 |
Gene, Accession # | Gene ID: 4113, UniProt: O15479, ENSG00000099399 |
Catalog # | HPA075519 |
Price | |
Order / More Info | MAGEB2 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |