| Edit |   |
| Antigenic Specificity | NMBR - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-NMBR Antibody - N-terminal region |
| Immunogen | The immunogen for anti-NMBR antibody: synthetic peptide directed towards the N terminal of human NMBR. Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL |
| Other Names | BB1, neuromedin B receptor |
| Gene, Accession # | NMBR, Accession: NM_002511 |
| Catalog # | TA344313 |
| Price | |
| Order / More Info | NMBR - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |