Edit |   |
Antigenic Specificity | MCOLN2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 36%, rat 36%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human MCOLN2 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKF |
Other Names | mucolipin 2, FLJ36691, TRP-ML2, TRPML2 |
Gene, Accession # | Gene ID: 255231, UniProt: Q8IZK6, ENSG00000153898 |
Catalog # | HPA048999 |
Price | |
Order / More Info | MCOLN2 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |