Edit |   |
Antigenic Specificity | PSCA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 63%, rat 65%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human PSCA polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKN |
Other Names | prostate stem cell antigen |
Gene, Accession # | Gene ID: 8000, UniProt: O43653, ENSG00000167653 |
Catalog # | HPA056418 |
Price | |
Order / More Info | PSCA Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |